Anti-Rpp21 (rat) antibodies | |
Protein name(s) | Protein Rpp21; Putative uncharacterized protein Flj22638; Ribonuclease P 21 subunit (Human), isoform CRA_c; |
Gene name(s) | Rpp21; 2781a1 2788a1a2 2795a1 2800a1a2 2812a1a2 2824a1 2829a1a2 2846a1a2 2860a1 2865a2 2869a1a2 2879a1 2886a1-a1a2 2901a1a2 2906a1 2920a1a2 2927a1 2941a1a2 2945a1a2 2950a1 2953a1a2 2959a1 2976a1 2981a1a2 2984a1a2 2994a1 3082ex4-5 Flj22638 Nerg-ps11 Nerg-p癷?癸 |
Cross ref(s) | NP_001002831.1; |
Length | 150 AA |
AbClass™ | Easy (learn more) |
Sequence | MAGQVKDREAFQRLNFLYQAAHCVLSQNPENQALARFYCHTEKTIAKRLVLRQDPSVKRTLCRDCSSLLIPGLTCTQRQRRRKGQRWTVQTCLTCQRSQRFLNDPKHLLWGDRPEAQLENQADFKPSEPLPNIADLSKENVQTQALNTTE |
Antibodies available |
Each product listed below is a combination of individual monoclonal antibodies (mAbs) against a panel of synthetic peptide antigens from the corresponding region of the target protein. Each combination of mAbs is recommended to be used directly. Later, they can be deconvoluted (if necessary) as individual monoclonal antibodies after epitope determination for each single mAb. Epitope determination service is available at $100 per combination. |
X-Q6MFZ6 -N | |
Description | A combination of mouse monoclonal antibodies against Q6MFZ6 N terminus sequence |
Antigen information | 3 synthetic peptides representing the N terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
X-Q6MFZ6 -C | |
Description | A combination of mouse monoclonal antibodies against Q6MFZ6 C terminus sequence |
Antigen information | 3 synthetic peptides representing the C terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
X-Q6MFZ6 -M | |
Description | A combination of mouse monoclonal antibodies against Q6MFZ6 M terminus sequence |
Antigen information | 3 synthetic peptides representing the non-terminus sequence |
Tested application | ELISA titer (antibody-antigen interaction): 10,000; approx. corresponding to 1 ng detection of target protein on WB |
Purchase Options for Total Protein Detection |
Choose a recommended package covered by AbInsure™ program. | |||||
End-use | Recommended package | Price | Description | Availability | |
WB | X1 -Q6MFZ6 | $ 599 | AbInsure™ | Delivered in 30 days | |
1 antibody combination included | |||||
X-Q6MFZ6 - N |
Or choose a single combination (NOT covered by AbInsure™ program) | ||
Antibodies available | Price | Availability |
X-Q6MFZ6 -N | $599 | Delivered in 30 days |
X-Q6MFZ6 -C | $599 | Delivered in 30 days |
X-Q6MFZ6 -M | $599 | Delivered in 30 days |
Or freely design a custom antibody development project (NOT covered by AbInsure™ program). |
We design and produce custom monoclonal antibodies tailored for your specific needs. If you cannot find antibodies you need from the above list, please don't hesitate to contact us for a free consultation. - Functional (blocking or neutrualizing) - Family cross-reactive or family distinguishing - Specific epitope(s) - Other special needs |
Any protein in rat
From $599
5 – 30 days to deliver
Find yours by protein name,
gene symbol or accession number